Lineage for d4z9me1 (4z9m E:47-137)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740708Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 1740709Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 1740768Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 1740769Protein automated matches [226884] (6 species)
    not a true protein
  7. 1740773Species Human (Homo sapiens) [TaxId:9606] [225065] (5 PDB entries)
  8. 1740792Domain d4z9me1: 4z9m E:47-137 [271850]
    Other proteins in same PDB: d4z9ma2, d4z9mb2, d4z9mc2, d4z9md2, d4z9me2, d4z9mf2, d4z9mg2, d4z9mh2
    automated match to d1crka1
    complexed with adp, unx

Details for d4z9me1

PDB Entry: 4z9m (more details), 2.1 Å

PDB Description: crystal structure of human sarcomeric mitochondrial creatine kinase
PDB Compounds: (E:) Creatine kinase S-type, mitochondrial

SCOPe Domain Sequences for d4z9me1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9me1 a.83.1.0 (E:47-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfiktv
gmvagdeesyevfadlfdpviklrhngydpr

SCOPe Domain Coordinates for d4z9me1:

Click to download the PDB-style file with coordinates for d4z9me1.
(The format of our PDB-style files is described here.)

Timeline for d4z9me1: