SCOPe 2.05: Domain d4z9mc2: 4z9m C:138-416

Lineage for d4z9mc2 (4z9m C:138-416)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
   automatically mapped to Pfam PF00217

6. Protein automated matches [226885] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225066] (5 PDB entries)

8. Domain d4z9mc2: 4z9m C:138-416 [271839]
   Other proteins in same PDB: d4z9ma1, d4z9mb1, d4z9mc1, d4z9md1, d4z9me1, d4z9mf1, d4z9mg1, d4z9mh1
   automated match to d1crka2
   complexed with adp, unx

Details for d4z9mc2

PDB Entry: 4z9m, 2.1 Å

PDB Description: crystal structure of human sarcomeric mitochondrial creatine kinase

PDB Compounds: (C:) Creatine kinase S-type, mitochondrial

SCOPe Domain Sequences for d4z9mc2:

Sequence; same for both SEQRES and ATOM records:

>d4z9mc2 d.128.1.2 (C:138-416) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vmkhttdldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitale
glkgdlagryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydk
tfliwineedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltc
psnlgtglragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrig
rsevelvqividgvnylvdcekklergqdikvppplpqf

Timeline for d4z9mc2:

• d4z9mc2 is new in SCOPe 2.05-stable
  
• d4z9mc2 appears in SCOPe 2.06
  
• d4z9mc2 appears in the current release, SCOPe 2.08