Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Ignisphaera aggregans [TaxId:583356] [271788] (3 PDB entries) |
Domain d4xdzb2: 4xdz B:184-330 [271808] Other proteins in same PDB: d4xdza1, d4xdzb1 automated match to d1np3a1 complexed with 40e, epe, gol, mg, ndp |
PDB Entry: 4xdz (more details), 1.15 Å
SCOPe Domain Sequences for d4xdzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdzb2 a.100.1.0 (B:184-330) automated matches {Ignisphaera aggregans [TaxId: 583356]} fkeetetdlfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliyekg ltgmlravsdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmptvf kelselegstietvgrklremmfrgmk
Timeline for d4xdzb2: