Lineage for d4xdya1 (4xdy A:1-187)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2109276Species Uncultured archaeon [TaxId:285389] [271793] (1 PDB entry)
  8. 2109277Domain d4xdya1: 4xdy A:1-187 [271805]
    Other proteins in same PDB: d4xdya2, d4xdyb2
    automated match to d4kqxb1
    complexed with gol, hio, mg, nai

Details for d4xdya1

PDB Entry: 4xdy (more details), 1.54 Å

PDB Description: structure of nadh-preferring ketol-acid reductoisomerase from an uncultured archean
PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xdya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdya1 c.2.1.0 (A:1-187) automated matches {Uncultured archaeon [TaxId: 285389]}
meilhdedvddsilrdktiavmgygaqgdaqanclkdsginvvigeteilggnknpswek
akedgfevlpidkaaekgdvvhillpdevqpaiyenqikpqlkagkalcfshgfnicfkr
ivppedvdvimvapkapgteerkaylegfgvpglvavkqnpsgearevalamtkamhwtk
agilect

SCOPe Domain Coordinates for d4xdya1:

Click to download the PDB-style file with coordinates for d4xdya1.
(The format of our PDB-style files is described here.)

Timeline for d4xdya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xdya2