Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Jc polyomavirus type 3 [TaxId:804310] [271736] (6 PDB entries) |
Domain d4x10e_: 4x10 E: [271776] automated match to d4mbzj_ complexed with edo, gol, k |
PDB Entry: 4x10 (more details), 1.9 Å
SCOPe Domain Sequences for d4x10e_:
Sequence, based on SEQRES records: (download)
>d4x10e_ b.121.6.1 (E:) automated matches {Jc polyomavirus type 3 [TaxId: 804310]} vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva riplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhf fsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpd ptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmft nrsgsqqwrglsryfkvqlrkrrvk
>d4x10e_ b.121.6.1 (E:) automated matches {Jc polyomavirus type 3 [TaxId: 804310]} vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva riplpnlnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggea lelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent ryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq wrglsryfkvqlrkrrvk
Timeline for d4x10e_:
View in 3D Domains from other chains: (mouse over for more information) d4x10a_, d4x10b_, d4x10c_, d4x10d_ |