SCOPe 2.08: Domain d4wela1: 4wel A:51-221

Lineage for d4wela1 (4wel A:51-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:652611] [271719] (2 PDB entries)

8. Domain d4wela1: 4wel A:51-221 [271721]
   Other proteins in same PDB: d4wela2
   automated match to d4kqra1
   complexed with 3le

Details for d4wela1

PDB Entry: 4wel, 1.99 Å

PDB Description: crystal structure of pseudomonas aeruginosa pbp3 with smc-3176

PDB Compounds: (A:) penicillin-binding protein 3

SCOPe Domain Sequences for d4wela1:

Sequence; same for both SEQRES and ATOM records:

>d4wela1 d.175.1.0 (A:51-221) automated matches {Pseudomonas aeruginosa [TaxId: 652611]}
rsvrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklf
adrieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdv
ddrgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Timeline for d4wela1:

• d4wela1 first appeared in SCOPe 2.05
  
• d4wela1 appears in SCOPe 2.07