Lineage for d1hmr__ (1hmr -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16579Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins)
  6. 16652Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)
  7. 16655Species Human (Homo sapiens) [TaxId:9606] [50849] (4 PDB entries)
  8. 16658Domain d1hmr__: 1hmr - [27170]

Details for d1hmr__

PDB Entry: 1hmr (more details), 1.4 Å

PDB Description: 1.4 angstroms structural studies on human muscle fatty acid binding protein: binding interactions with three saturated and unsaturated c18 fatty acids

SCOP Domain Sequences for d1hmr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmr__ b.60.1.2 (-) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens)}
vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyeke

SCOP Domain Coordinates for d1hmr__:

Click to download the PDB-style file with coordinates for d1hmr__.
(The format of our PDB-style files is described here.)

Timeline for d1hmr__: