Lineage for d1hmra_ (1hmr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805192Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)
  7. 2805195Species Human (Homo sapiens) [TaxId:9606] [50849] (22 PDB entries)
  8. 2805210Domain d1hmra_: 1hmr A: [27170]
    complexed with ela

Details for d1hmra_

PDB Entry: 1hmr (more details), 1.4 Å

PDB Description: 1.4 angstroms structural studies on human muscle fatty acid binding protein: binding interactions with three saturated and unsaturated c18 fatty acids
PDB Compounds: (A:) muscle fatty acid binding protein

SCOPe Domain Sequences for d1hmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmra_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyeke

SCOPe Domain Coordinates for d1hmra_:

Click to download the PDB-style file with coordinates for d1hmra_.
(The format of our PDB-style files is described here.)

Timeline for d1hmra_: