Lineage for d4qqoa_ (4qqo A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2049110Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2049111Protein automated matches [190873] (4 species)
    not a true protein
  7. 2049177Species Mouse (Mus musculus) [TaxId:10090] [271469] (8 PDB entries)
  8. 2049184Domain d4qqoa_: 4qqo A: [271692]
    automated match to d2ka3a_
    complexed with mg; mutant

Details for d4qqoa_

PDB Entry: 4qqo (more details), 2.03 Å

PDB Description: crystal structure of c1ql3 mutant d205a
PDB Compounds: (A:) Complement C1q-like protein 3

SCOPe Domain Sequences for d4qqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qqoa_ b.22.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
smwadlcknnqvrasaiaqaadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
tfsgfiiyad

SCOPe Domain Coordinates for d4qqoa_:

Click to download the PDB-style file with coordinates for d4qqoa_.
(The format of our PDB-style files is described here.)

Timeline for d4qqoa_: