SCOPe 2.06: Domain d4ozgd2: 4ozg D:93-190

Lineage for d4ozgd2 (4ozg D:93-190)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4ozgd2: 4ozg D:93-190 [271657]
   Other proteins in same PDB: d4ozga1, d4ozga2, d4ozgb1, d4ozgc1, d4ozgc2, d4ozgd1, d4ozge2, d4ozgf2, d4ozgg2, d4ozgh2
   automated match to d1sebb1
   complexed with ca, nag

Details for d4ozgd2

PDB Entry: 4ozg, 3 Å

PDB Description: d2 protein complex

PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozgd2:

Sequence, based on SEQRES records:

>d4ozgd2 b.1.1.0 (D:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewra

Sequence, based on observed residues (ATOM records):

>d4ozgd2 b.1.1.0 (D:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvm
lemtpqrgdvytchvehpslqspitvewra

Timeline for d4ozgd2:

• d4ozgd2 first appeared in SCOPe 2.05
  
• d4ozgd2 appears in SCOPe 2.07
  
• d4ozgd2 appears in the current release, SCOPe 2.08