Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d4ozgg1: 4ozg G:2-129 [271654] Other proteins in same PDB: d4ozga1, d4ozga2, d4ozgb1, d4ozgc1, d4ozgc2, d4ozgd1, d4ozge2, d4ozgf2, d4ozgg2, d4ozgh2 automated match to d2pyfa1 complexed with ca, nag |
PDB Entry: 4ozg (more details), 3 Å
SCOPe Domain Sequences for d4ozgg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozgg1 b.1.1.0 (G:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas liitedrksstlilphatlrdtavyycivlggadgltfgkgthliiqpy
Timeline for d4ozgg1: