Lineage for d4ozgc2 (4ozg C:82-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751795Domain d4ozgc2: 4ozg C:82-180 [271653]
    Other proteins in same PDB: d4ozga1, d4ozgb1, d4ozgb2, d4ozgc1, d4ozgd1, d4ozgd2, d4ozge1, d4ozgf1, d4ozgg1, d4ozgh1
    automated match to d4ozfa2
    complexed with ca, nag

Details for d4ozgc2

PDB Entry: 4ozg (more details), 3 Å

PDB Description: d2 protein complex
PDB Compounds: (C:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d4ozgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozgc2 b.1.1.2 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltllpsaeesydckvehwgldkpllkhwep

SCOPe Domain Coordinates for d4ozgc2:

Click to download the PDB-style file with coordinates for d4ozgc2.
(The format of our PDB-style files is described here.)

Timeline for d4ozgc2: