Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core. |
Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (2 families) binds UDP group |
Family c.98.1.0: automated matches [271609] (1 protein) not a true family |
Protein automated matches [271613] (1 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271617] (3 PDB entries) |
Domain d4cvma1: 4cvm A:1-100 [271626] Other proteins in same PDB: d4cvma2, d4cvma3 automated match to d1gg4a3 complexed with ala, anp, fga, mg, mub, udp |
PDB Entry: 4cvm (more details), 2.06 Å
SCOPe Domain Sequences for d4cvma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cvma1 c.98.1.0 (A:1-100) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mleplrlsqltvaldarligedavfsavstdsraigpgelfialsgprfdghdylaevaa kgavaalverevadaplpqllvrdtraalgrlgalnrrkf
Timeline for d4cvma1: