Lineage for d5ak2b_ (5ak2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2013274Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2013275Protein automated matches [191142] (6 species)
    not a true protein
  7. 2013288Species Human (Homo sapiens) [TaxId:9606] [189274] (54 PDB entries)
  8. 2013333Domain d5ak2b_: 5ak2 B: [271608]
    Other proteins in same PDB: d5ak2a2
    automated match to d2pjla_
    complexed with 85z

Details for d5ak2b_

PDB Entry: 5ak2 (more details), 2.19 Å

PDB Description: oxyphenylpropenoic acids as oral selective estrogen receptor down- regulators.
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d5ak2b_:

Sequence, based on SEQRES records: (download)

>d5ak2b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgf
vdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdm
llatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtli
hlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld

Sequence, based on observed residues (ATOM records): (download)

>d5ak2b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsltadqmvsalldaeppilysepfseasmmglltnladrelvhminwakrvpgfvdltl
hdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllats
srfrmmnlqgeefvclksiillnsgvykdhihrvldkitdtlihlmakagltlqqqhqrl
aqlllilshirhmsnkgmehlysmllemld

SCOPe Domain Coordinates for d5ak2b_:

Click to download the PDB-style file with coordinates for d5ak2b_.
(The format of our PDB-style files is described here.)

Timeline for d5ak2b_: