Lineage for d5ak2a_ (5ak2 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1748271Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 1748272Protein automated matches [191142] (5 species)
    not a true protein
  7. 1748280Species Human (Homo sapiens) [TaxId:9606] [189274] (19 PDB entries)
  8. 1748295Domain d5ak2a_: 5ak2 A: [271607]
    automated match to d2pjla_
    complexed with 85z

Details for d5ak2a_

PDB Entry: 5ak2 (more details), 2.19 Å

PDB Description: oxyphenylpropenoic acids as oral selective estrogen receptor down- regulators.
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d5ak2a_:

Sequence, based on SEQRES records: (download)

>d5ak2a_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwak
rvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmv
eifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldki
tdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydllle
mldahrlhap

Sequence, based on observed residues (ATOM records): (download)

>d5ak2a_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmalsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltl
hdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllats
srfrmmnlqgeefvclksiillnsgvytsleekdhihrvldkitdtlihlmakagltlqq
qhqrlaqlllilshirhmsnkgmehlysmvpsydlllemldahrlhap

SCOPe Domain Coordinates for d5ak2a_:

Click to download the PDB-style file with coordinates for d5ak2a_.
(The format of our PDB-style files is described here.)

Timeline for d5ak2a_:

  • d5ak2a_ appears in periodic updates to SCOPe 2.05 starting on 2015-04-22
  • d5ak2a_ is called d5ak2a1 in SCOPe 2.06
  • d5ak2a_ appears in the current release, SCOPe 2.07, called d5ak2a1