Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein automated matches [190296] (11 species) not a true protein |
Species Streptobacillus moniliformis [TaxId:519441] [271603] (1 PDB entry) |
Domain d4z0na_: 4z0n A: [271604] automated match to d2gbpa_ complexed with act, ca, edo, gal, na, so4 |
PDB Entry: 4z0n (more details), 1.26 Å
SCOPe Domain Sequences for d4z0na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z0na_ c.93.1.1 (A:) automated matches {Streptobacillus moniliformis [TaxId: 519441]} kitlgvtyykfddnflagmrndmiqiakekypniellnndsqnsqsilndqievlinkgv nvlvinlvdptagqsvidkakaanipiilfnkdpgvdalnsydkawyvgttpkdsgilqg qviekawlanpaydlngdgviqyvmlfgepgqpdaeartkysieylnekgikteelhkdi anwdaaqakdkmdawlsgpnankievvianndgmalgavesikavkkelpvfgvdaiqea ltliekgemvgtvlqdatgqarailelanniangkeptegtewklidkavrvpyvgvdkd nykefqk
Timeline for d4z0na_: