Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (31 species) not a true protein |
Species Babesia bovis [TaxId:5865] [226663] (1 PDB entry) |
Domain d4yetb2: 4yet B:84-199 [271600] Other proteins in same PDB: d4yeta1, d4yetb1, d4yetb3 automated match to d4k2wa2 complexed with fe |
PDB Entry: 4yet (more details), 1.75 Å
SCOPe Domain Sequences for d4yetb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yetb2 d.44.1.0 (B:84-199) automated matches {Babesia bovis [TaxId: 5865]} ncggeptgpirkkieekfgsfsafktdfsnllaghfgsgwgwlvlkddgtadivqthdag splkenlgrpllccdvwehayyidykndrlsyinswwnlvnwdfanknleapfkws
Timeline for d4yetb2: