SCOPe 2.07: Domain d3wxvh_: 3wxv H:

Lineage for d3wxvh_ (3wxv H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d3wxvh_: 3wxv H: [271559]
   automated match to d1oauh_
   complexed with zn

Details for d3wxvh_

PDB Entry: 3wxv, 2.9 Å

PDB Description: crystal structure of the human adiponectin receptor 1

PDB Compounds: (H:) V region heavy chain

SCOPe Domain Sequences for d3wxvh_:

Sequence; same for both SEQRES and ATOM records:

>d3wxvh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa

Timeline for d3wxvh_:

• d3wxvh_ first appeared in SCOPe 2.05
  
• d3wxvh_ appears in SCOPe 2.06
  
• d3wxvh_ does not appear in SCOPe 2.08