SCOPe 2.08: Domain d3wtca_: 3wtc A:

Lineage for d3wtca_ (3wtc A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Gluconobacter oxydans [TaxId:290633] [271544] (3 PDB entries)

8. Domain d3wtca_: 3wtc A: [271546]
   automated match to d3pxxa_

Details for d3wtca_

PDB Entry: 3wtc, 1.65 Å

PDB Description: crystal structure of gox2036

PDB Compounds: (A:) Putative oxidoreductase

SCOPe Domain Sequences for d3wtca_:

Sequence; same for both SEQRES and ATOM records:

>d3wtca_ c.2.1.0 (A:) automated matches {Gluconobacter oxydans [TaxId: 290633]}
mslsgkiaavtgaaqgigkaialrlakdgadvilldvkqdtlaetakevealgrravalt
adisnrdqfrstladaaktlggldimvnnagicqvkpildiepaeiekifsinvqgvlwg
mqaaatlfkekgtkgkiinacsiaghegypllgaysatkfavraltqsaakelassgitv
nsycpgivgtdmwvtidkrmaeitgteigatykkyvegialgrvetaddvagfvaylsss
dadymtgqsvlidgglvfr

Timeline for d3wtca_:

• d3wtca_ first appeared in SCOPe 2.05
  
• d3wtca_ appears in SCOPe 2.07