Lineage for d4uwob_ (4uwo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996879Species Klebsiella pneumoniae [TaxId:573] [271524] (9 PDB entries)
  8. 2996884Domain d4uwob_: 4uwo B: [271527]
    automated match to d4ua4b_
    complexed with gol, na, zn

Details for d4uwob_

PDB Entry: 4uwo (more details), 1.56 Å

PDB Description: native di-zinc vim-26. leu224 in vim-26 from klebsiella pneumoniae has implications for drug binding.
PDB Compounds: (B:) metallo-beta-lactamase vim-26

SCOPe Domain Sequences for d4uwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uwob_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlelsstsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvkahkn

SCOPe Domain Coordinates for d4uwob_:

Click to download the PDB-style file with coordinates for d4uwob_.
(The format of our PDB-style files is described here.)

Timeline for d4uwob_: