Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (12 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [271524] (9 PDB entries) |
Domain d4uwob_: 4uwo B: [271527] automated match to d4ua4b_ complexed with gol, na, zn |
PDB Entry: 4uwo (more details), 1.56 Å
SCOPe Domain Sequences for d4uwob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uwob_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeaegneip thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlelsstsagnv adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvkahkn
Timeline for d4uwob_: