SCOPe 2.05: Domain d4qqha_: 4qqh A:

Lineage for d4qqha_ (4qqh A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (3 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [271469] (6 PDB entries)

8. Domain d4qqha_: 4qqh A: [271479]
   automated match to d2ka3a_
   complexed with cd

Details for d4qqha_

PDB Entry: 4qqh, 1.2 Å

PDB Description: crystal structure of c1ql3 in space group h32

PDB Compounds: (A:) Complement C1q-like protein 3

SCOPe Domain Sequences for d4qqha_:

Sequence; same for both SEQRES and ATOM records:

>d4qqha_ b.22.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
tfsgfiiyad

Timeline for d4qqha_:

• d4qqha_ is new in SCOPe 2.05-stable
  
• d4qqha_ appears in SCOPe 2.06
  
• d4qqha_ appears in the current release, SCOPe 2.08