SCOPe 2.08: Domain d4qpca2: 4qpc A:204-308

Lineage for d4qpca2 (4qpc A:204-308)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
   barrel, open; n*=6, S*=10; greek-key

4. Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families)

5. Family b.46.1.0: automated matches [227262] (1 protein)
   not a true family

6. Protein automated matches [227053] (7 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [271467] (6 PDB entries)

8. Domain d4qpca2: 4qpc A:204-308 [271475]
   Other proteins in same PDB: d4qpca1
   automated match to d2bw0a1

Details for d4qpca2

PDB Entry: 4qpc, 1.9 Å

PDB Description: crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) from zebrafish

PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d4qpca2:

Sequence; same for both SEQRES and ATOM records:

>d4qpca2 b.46.1.0 (A:204-308) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
qkkenskidwnqpaeaihnwirgndrvpgawaeidgksvsfygstllendhfssngqple
ipgasraalvtknglvlfgndgkmllvknlqfedgkmipgsqyfk

Timeline for d4qpca2:

• d4qpca2 first appeared in SCOPe 2.05
  
• d4qpca2 appears in SCOPe 2.07