Lineage for d4qpca1 (4qpc A:1-203)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.65: Formyltransferase [53327] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the restSuperfamily c.65.1: Formyltransferase [53328] (2 families) 
Family c.65.1.1: Formyltransferase [53329] (5 proteins) 
Protein automated matches [227063] (3 species)
not a true protein
Species Zebrafish (Danio rerio) [TaxId:7955] [271465] (6 PDB entries) 
Domain d4qpca1: 4qpc A:1-203 [271474]
Other proteins in same PDB: d4qpca2
automated match to d2bw0a2
Details for d4qpca1
PDB Entry: 4qpc (more details), 1.9 Å
PDB Description: crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) from zebrafish
PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenaseSCOPe Domain Sequences for d4qpca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qpca1 c.65.1.1 (A:1-203) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mkiavigqslfgqevykelkneghmivgvftipdkdgkvdplaieaekdgvpvfkfprwr
lkgkaitevvdqykavgaelnvlpfcsqfipmevidhpkhgsiiyhpsllprhrgasain
wtlihgdkkggftvfwaddgldtgpillqrecdvepndnvnsiykrflfpegvkgmveav
rliatgkaprikqpeegataeci
SCOPe Domain Coordinates for d4qpca1:
Click to download the PDB-style file with coordinates for d4qpca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4qpca1:
- d4qpca1 first appeared in SCOPe 2.05
- d4qpca1 appears in SCOPe 2.07
View in 3D
