SCOPe 2.05: Domain d4pljc2: 4plj C:108-211

Lineage for d4pljc2 (4plj C:108-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d4pljc2: 4plj C:108-211 [271459]
   Other proteins in same PDB: d4pljc1, d4pljl1
   automated match to d2fd6l2

Details for d4pljc2

PDB Entry: 4plj, 2.3 Å

PDB Description: hepatitis e virus e2s domain (genotype iv) in complex with a neutralizing antibody 8g12

PDB Compounds: (C:) 8G12 light chain

SCOPe Domain Sequences for d4pljc2:

Sequence, based on SEQRES records:

>d4pljc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppssekvlsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records):

>d4pljc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppssekvlsggasvvcflnnfypkdinvkwkidgsvlnswtdqdskdst
ysmsstltltkdeyerhnsytceatspivksfnr

Timeline for d4pljc2:

• d4pljc2 is new in SCOPe 2.05-stable
  
• d4pljc2 appears in SCOPe 2.06
  
• d4pljc2 appears in the current release, SCOPe 2.08