SCOPe 2.06: Domain d4o9hl2: 4o9h L:111-211

Lineage for d4o9hl2 (4o9h L:111-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Llama glama [TaxId:9844] [271450] (2 PDB entries)

8. Domain d4o9hl2: 4o9h L:111-211 [271451]
   Other proteins in same PDB: d4o9ha_, d4o9hl1
   automated match to d1aqkl2

Details for d4o9hl2

PDB Entry: 4o9h, 2.42 Å

PDB Description: structure of interleukin-6 in complex with a camelid fab fragment

PDB Compounds: (L:) Light Chain of the Camelid Fab fragment 61H7

SCOPe Domain Sequences for d4o9hl2:

Sequence; same for both SEQRES and ATOM records:

>d4o9hl2 b.1.1.2 (L:111-211) automated matches {Llama glama [TaxId: 9844]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d4o9hl2:

• d4o9hl2 first appeared in SCOPe 2.05
  
• d4o9hl2 appears in SCOPe 2.07
  
• d4o9hl2 appears in the current release, SCOPe 2.08