SCOPe 2.07: Domain d4o9hl1: 4o9h L:1-110

Lineage for d4o9hl1 (4o9h L:1-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Llama glama [TaxId:9844] [271448] (2 PDB entries)

8. Domain d4o9hl1: 4o9h L:1-110 [271449]
   Other proteins in same PDB: d4o9ha_, d4o9hl2
   automated match to d1aqkl1

Details for d4o9hl1

PDB Entry: 4o9h, 2.42 Å

PDB Description: structure of interleukin-6 in complex with a camelid fab fragment

PDB Compounds: (L:) Light Chain of the Camelid Fab fragment 61H7

SCOPe Domain Sequences for d4o9hl1:

Sequence; same for both SEQRES and ATOM records:

>d4o9hl1 b.1.1.0 (L:1-110) automated matches {Llama glama [TaxId: 9844]}
qtvvtqepslsvspggtvtltcglssgsvtasnypgwfqqtpgqapraliystndrhsgv
psrfsgsisgnkaaltitgaqpedeadyycaldigditefgggthltvlg

Timeline for d4o9hl1:

• d4o9hl1 first appeared in SCOPe 2.05
  
• d4o9hl1 appears in SCOPe 2.06
  
• d4o9hl1 appears in the current release, SCOPe 2.08