SCOPe 2.08: Domain d4qdqa1: 4qdq A:276-433

Lineage for d4qdqa1 (4qdq A:276-433)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)

8. Domain d4qdqa1: 4qdq A:276-433 [271425]
   Other proteins in same PDB: d4qdqa3, d4qdqb3
   automated match to d2qqja1
   complexed with gol, so4

Details for d4qdqa1

PDB Entry: 4qdq, 1.95 Å

PDB Description: physical basis for nrp2 ligand binding

PDB Compounds: (A:) Neuropilin-2

SCOPe Domain Sequences for d4qdqa1:

Sequence; same for both SEQRES and ATOM records:

>d4qdqa1 b.18.1.0 (A:276-433) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdlrf
ltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatevvl
nklhaplltrfvrirpqtwhsgialrlelfgcrvtdap

Timeline for d4qdqa1:

• d4qdqa1 first appeared in SCOPe 2.05
  
• d4qdqa1 appears in SCOPe 2.07