Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (28 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [271413] (1 PDB entry) |
Domain d4q16b_: 4q16 B: [271415] automated match to d2pzaa_ complexed with so4 |
PDB Entry: 4q16 (more details), 2.6 Å
SCOPe Domain Sequences for d4q16b_:
Sequence, based on SEQRES records: (download)
>d4q16b_ c.26.2.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]} plsplrshiirelhvqpdidpgaeverrvaflcdylqstptkgfvlgisggqdstlagrl cqlaverrrsqghgatflavrlpygvqadeadaqqaldfiqadrevtvnikeaadasvaa aqaalgsevrdfvrgnvkarermvaqyalagqenllvvgtdhaaealtgfytkygdggvd ltplsgltkrqgaqllahlgapegtwrkvptadleddrpglpdevalgvtyaqidayleg revsdeaaarlerlflnsrhkralpvtpfdgwwqp
>d4q16b_ c.26.2.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]} plsplrshiirelhvqpdidpgaeverrvaflcdylqstptkgfvlgisggqdstlagrl cqlaverrrsqghgatflavrlpygvqadeadaqqaldfiqadrevtvnikeaadasvaa aqaalgsevrdfvrgnvkarermvaqyalagqenllvvgtdhaaealtgfytkygdggvd ltplsgltkrqgaqllahlgapegtwrkddrpglpdevalgvtyaqidaylegrevsdea aarlerlflnsrhkralpvtpfdgwwqp
Timeline for d4q16b_: