Lineage for d4q16b_ (4q16 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861575Species Deinococcus radiodurans [TaxId:243230] [271413] (1 PDB entry)
  8. 2861577Domain d4q16b_: 4q16 B: [271415]
    automated match to d2pzaa_
    complexed with so4

Details for d4q16b_

PDB Entry: 4q16 (more details), 2.6 Å

PDB Description: structure of nad+ synthetase from deinococcus radiodurans
PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d4q16b_:

Sequence, based on SEQRES records: (download)

>d4q16b_ c.26.2.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
plsplrshiirelhvqpdidpgaeverrvaflcdylqstptkgfvlgisggqdstlagrl
cqlaverrrsqghgatflavrlpygvqadeadaqqaldfiqadrevtvnikeaadasvaa
aqaalgsevrdfvrgnvkarermvaqyalagqenllvvgtdhaaealtgfytkygdggvd
ltplsgltkrqgaqllahlgapegtwrkvptadleddrpglpdevalgvtyaqidayleg
revsdeaaarlerlflnsrhkralpvtpfdgwwqp

Sequence, based on observed residues (ATOM records): (download)

>d4q16b_ c.26.2.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
plsplrshiirelhvqpdidpgaeverrvaflcdylqstptkgfvlgisggqdstlagrl
cqlaverrrsqghgatflavrlpygvqadeadaqqaldfiqadrevtvnikeaadasvaa
aqaalgsevrdfvrgnvkarermvaqyalagqenllvvgtdhaaealtgfytkygdggvd
ltplsgltkrqgaqllahlgapegtwrkddrpglpdevalgvtyaqidaylegrevsdea
aarlerlflnsrhkralpvtpfdgwwqp

SCOPe Domain Coordinates for d4q16b_:

Click to download the PDB-style file with coordinates for d4q16b_.
(The format of our PDB-style files is described here.)

Timeline for d4q16b_: