SCOPe 2.08: Domain d4omka1: 4omk A:1-75

Lineage for d4omka1 (4omk A:1-75)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.0: automated matches [227224] (1 protein)
   not a true family

6. Protein automated matches [226965] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [258515] (4 PDB entries)

8. Domain d4omka1: 4omk A:1-75 [271397]
   Other proteins in same PDB: d4omka2, d4omkb2
   automated match to d1olma1
   complexed with cl, ipa, so4, sql

Details for d4omka1

PDB Entry: 4omk, 1.75 Å

PDB Description: crystal structure of spf bound to squalene

PDB Compounds: (A:) sec14-like protein 2

SCOPe Domain Sequences for d4omka1:

Sequence; same for both SEQRES and ATOM records:

>d4omka1 a.5.3.0 (A:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
efrkqkdidniiswq

Timeline for d4omka1:

• d4omka1 first appeared in SCOPe 2.05
  
• d4omka1 appears in SCOPe 2.07