SCOPe 2.05: Domain d2mmna_: 2mmn A:

Lineage for d2mmna_ (2mmn A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (15 species)

7. Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries)

8. Domain d2mmna_: 2mmn A: [271391]
   automated match to d4j56e_

Details for d2mmna_

PDB Entry: 2mmn

PDB Description: solution structure of the reduced thioredoxin from plasmodium falciparum

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2mmna_:

Sequence; same for both SEQRES and ATOM records:

>d2mmna_ c.47.1.1 (A:) Thioredoxin {Plasmodium falciparum [TaxId: 36329]}
svkivtsqsefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdev
sevtekenitsmptfkvykngssvdtllgandsalkqliekyaa

Timeline for d2mmna_:

• d2mmna_ is new in SCOPe 2.05-stable
  
• d2mmna_ is called d2mmna1 in SCOPe 2.06
  
• d2mmna_ appears in the current release, SCOPe 2.08, called d2mmna1