Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (16 species) |
Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries) |
Domain d2mmoa1: 2mmo A:2-104 [271390] Other proteins in same PDB: d2mmoa2 automated match to d4j56e_ |
PDB Entry: 2mmo (more details)
SCOPe Domain Sequences for d2mmoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mmoa1 c.47.1.1 (A:2-104) Thioredoxin {Plasmodium falciparum [TaxId: 36329]} vkivtsqsefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs evtekenitsmptfkvykngssvdtllgandsalkqliekyaa
Timeline for d2mmoa1: