SCOPe 2.08: Domain d2mmoa1: 2mmo A:2-104

Lineage for d2mmoa1 (2mmo A:2-104)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries)

8. Domain d2mmoa1: 2mmo A:2-104 [271390]
   Other proteins in same PDB: d2mmoa2
   automated match to d4j56e_

Details for d2mmoa1

PDB Entry: 2mmo

PDB Description: solution structure of the oxidised thioredoxin from plasmodium falciparum

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2mmoa1:

Sequence; same for both SEQRES and ATOM records:

>d2mmoa1 c.47.1.1 (A:2-104) Thioredoxin {Plasmodium falciparum [TaxId: 36329]}
vkivtsqsefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
evtekenitsmptfkvykngssvdtllgandsalkqliekyaa

Timeline for d2mmoa1:

• d2mmoa1 first appeared in SCOPe 2.05, called d2mmoa_
  
• d2mmoa1 appears in SCOPe 2.07