Lineage for d4yiiu_ (4yii U:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2184242Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2184243Protein automated matches [190120] (8 species)
    not a true protein
  7. 2184251Species Human (Homo sapiens) [TaxId:9606] [186843] (19 PDB entries)
  8. 2184256Domain d4yiiu_: 4yii U: [271375]
    automated match to d4l83a_

Details for d4yiiu_

PDB Entry: 4yii (more details), 1.8 Å

PDB Description: structure of an apc2-ubch10 complex reveals distinctive cullin-ring ligase mechanism for anaphase-promoting complex/cyclosome
PDB Compounds: (U:) Ubiquitin-conjugating enzyme E2 C

SCOPe Domain Sequences for d4yiiu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yiiu_ d.20.1.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsg
ypynaptvkfltpcyhpnvdtqgnicldilkekwsalydvrtillsiqsllgepnidspl
nthaaelwknptafkkylqetyskq

SCOPe Domain Coordinates for d4yiiu_:

Click to download the PDB-style file with coordinates for d4yiiu_.
(The format of our PDB-style files is described here.)

Timeline for d4yiiu_: