SCOPe 2.08: Domain d4y8dd1: 4y8d D:6-121

Lineage for d4y8dd1 (4y8d D:6-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4y8dd1: 4y8d D:6-121 [271373]
   Other proteins in same PDB: d4y8dc2, d4y8dd2
   automated match to d1ieha_
   complexed with 49j, edo

Details for d4y8dd1

PDB Entry: 4y8d, 2.1 Å

PDB Description: crystal structure of cyclin-g associated kinase (gak) complexed with selective 12i inhibitor

PDB Compounds: (D:) Nanobody

SCOPe Domain Sequences for d4y8dd1:

Sequence; same for both SEQRES and ATOM records:

>d4y8dd1 b.1.1.1 (D:6-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgggsvqaggslrlscgaseytsrmgwfrqapgaeregvacihrqsnlsyysdsvrgrf
tisqdnakttafllmsslkpedtaiyycatttdcaafverataitagqgtqvtvss

Timeline for d4y8dd1:

• d4y8dd1 first appeared in SCOPe 2.05, called d4y8dd_
  
• d4y8dd1 appears in SCOPe 2.07