Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
Domain d4y2ba_: 4y2b A: [271340] automated match to d4pm0a_ complexed with epk, mg, zn |
PDB Entry: 4y2b (more details), 2.2 Å
SCOPe Domain Sequences for d4y2ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y2ba_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dyngqakcmlekvgnwnfdiflfdrltngnslvsltfhlfslhglieyfhldmmklrrfl vmiqedyhsqnpyhnavhaadvtqamhcylkepklansvtpwdillsliaaathdldhpg vnqpfliktnhylatlykntsvlenhhwrsavgllresglfshlplesrqqmetqigali latdisrqneylslfrshldrgdlcledtrhrhlvlqmalkcadicnpcrtwelskqwse kvteeffhqgdiekkyhlgvsplcdrhtesianiqigfmtylveplftewarfsntrlsq tmlghvglnkaswkglqr
Timeline for d4y2ba_: