Lineage for d4xtja2 (4xtj A:221-392)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1892409Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1892410Protein automated matches [190826] (17 species)
    not a true protein
  7. 1892459Species Escherichia coli [TaxId:83333] [271300] (4 PDB entries)
  8. 1892462Domain d4xtja2: 4xtj A:221-392 [271336]
    Other proteins in same PDB: d4xtja1
    automated match to d4prxa2
    complexed with anp, cl, k, mg, na

Details for d4xtja2

PDB Entry: 4xtj (more details), 1.92 Å

PDB Description: n-terminal 43 kda fragment of the e. coli dna gyrase b subunit grown from 100 mm kcl plus 100 mm nacl condition
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4xtja2:

Sequence, based on SEQRES records: (download)

>d4xtja2 d.14.1.0 (A:221-392) automated matches {Escherichia coli [TaxId: 83333]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyskkakvsatgddaregliavvsvkvpdpkfssqtkdkl
vssevksaveqqmnellaeyllenptdakivvgkiidaarareaarraremt

Sequence, based on observed residues (ATOM records): (download)

>d4xtja2 d.14.1.0 (A:221-392) automated matches {Escherichia coli [TaxId: 83333]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyssatgddaregliavvsvkvpdpkfssqtkdklvssev
ksaveqqmnellaeyllenptdakivvgkiidaarareaarraremt

SCOPe Domain Coordinates for d4xtja2:

Click to download the PDB-style file with coordinates for d4xtja2.
(The format of our PDB-style files is described here.)

Timeline for d4xtja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xtja1