SCOPe 2.05: Domain d3wuda_: 3wud A:

Lineage for d3wuda_ (3wud A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Xenopus laevis [TaxId:8355] [271304] (2 PDB entries)

8. Domain d3wuda_: 3wud A: [271311]
   automated match to d1slca_
   complexed with so4

Details for d3wuda_

PDB Entry: 3wud, 1.68 Å

PDB Description: x-ray crystal structure of xenopus laevis galectin-ib

PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d3wuda_:

Sequence; same for both SEQRES and ATOM records:

>d3wuda_ b.29.1.0 (A:) automated matches {Xenopus laevis [TaxId: 8355]}
agmvmnnfslkqghclelkgfipkdaksfainlgkdssnyvihfnprfdhegdtnkiicn
skeenswgteqrenvfpfqqgaetsicfeyqadhlkvklsdgqefnfpirmpldtitfls
mdgielkaislh

Timeline for d3wuda_:

• d3wuda_ is new in SCOPe 2.05-stable
  
• d3wuda_ appears in SCOPe 2.06
  
• d3wuda_ appears in the current release, SCOPe 2.08