SCOPe 2.06: Domain d4wuda1: 4wud A:4-220

Lineage for d4wuda1 (4wud A:4-220)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (14 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [271298] (4 PDB entries)

8. Domain d4wuda1: 4wud A:4-220 [271299]
   Other proteins in same PDB: d4wuda2
   automated match to d4prxa1
   complexed with anp, cl, mg, na

Details for d4wuda1

PDB Entry: 4wud, 1.95 Å

PDB Description: n-terminal 43 kda fragment of the e. coli dna gyrase b subunit grown from no salt condition

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4wuda1:

Sequence; same for both SEQRES and ATOM records:

>d4wuda1 d.122.1.0 (A:4-220) automated matches {Escherichia coli [TaxId: 83333]}
sydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivti
hadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvv
nalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefe
yeilakrlrelsflnsgvsirlrdkrdgkedhfhyeg

Timeline for d4wuda1:

• d4wuda1 first appeared in SCOPe 2.05
  
• d4wuda1 appears in SCOPe 2.07
  
• d4wuda1 appears in the current release, SCOPe 2.08