Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (16 species) not a true protein |
Species Struthio camelus [TaxId:8801] [271269] (2 PDB entries) |
Domain d4uxma_: 4uxm A: [271271] automated match to d1jzna_ complexed with be7 |
PDB Entry: 4uxm (more details), 1.5 Å
SCOPe Domain Sequences for d4uxma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uxma_ d.169.1.0 (A:) automated matches {Struthio camelus [TaxId: 8801]} kcpkgwldfrgncygyfryelpwkraeawcrsiragahlasihtseehraiakfisqyhh geeeedvwiglfrwnsvwawidgskkhysalddddypkgkhcavldessgflswdndscg ernafickcta
Timeline for d4uxma_: