Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Cow (Bos taurus) [TaxId:9913] [224919] (41 PDB entries) |
Domain d4s22a_: 4s22 A: [271240] automated match to d1ogwa_ complexed with edo, gol, iod |
PDB Entry: 4s22 (more details), 2.3 Å
SCOPe Domain Sequences for d4s22a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s22a_ d.15.1.1 (A:) Ubiquitin {Cow (Bos taurus) [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrl
Timeline for d4s22a_: