SCOPe 2.08: Domain d4yyxb1: 4yyx B:18-120

Lineage for d4yyxb1 (4yyx B:18-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)

8. Domain d4yyxb1: 4yyx B:18-120 [271161]
   Other proteins in same PDB: d4yyxa2, d4yyxb2
   automated match to d2h2ba_
   complexed with fmt

Details for d4yyxb1

PDB Entry: 4yyx, 1.79 Å

PDB Description: crystal structure of the zo-1 pdz1 domain in complex with the 7-mer claudin2 c-terminal tail

PDB Compounds: (B:) Tight junction protein ZO-1 fused with Claudin-2 C-terminal

SCOPe Domain Sequences for d4yyxb1:

Sequence; same for both SEQRES and ATOM records:

>d4yyxb1 b.36.1.1 (B:18-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrvam
vngvsmdnvehafavqqlrksgknakitirrkkgggysltgyv

Timeline for d4yyxb1:

• d4yyxb1 first appeared in SCOPe 2.05, called d4yyxb_
  
• d4yyxb1 appears in SCOPe 2.07