Lineage for d4yuda1 (4yud A:144-229)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195506Protein automated matches [190332] (5 species)
    not a true protein
  7. 2195509Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2195512Domain d4yuda1: 4yud A:144-229 [271154]
    Other proteins in same PDB: d4yuda2
    automated match to d2mhna_

Details for d4yuda1

PDB Entry: 4yud (more details), 1.28 Å

PDB Description: crystal structure of a rna binding motif protein 39 (rbm39) from homo sapiens at 1.28 a resolution
PDB Compounds: (A:) RNA-binding protein 39

SCOPe Domain Sequences for d4yuda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yuda1 d.58.7.1 (A:144-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nltpeerdartvfcmqlaarirprdleeffstvgkvrdvrmisdrnsrrskgiayvefvd
vssvplaigltgqrvlgvpiivqasq

SCOPe Domain Coordinates for d4yuda1:

Click to download the PDB-style file with coordinates for d4yuda1.
(The format of our PDB-style files is described here.)

Timeline for d4yuda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yuda2