Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Moesin [50777] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [311105] (1 PDB entry) |
Domain d4yl8a3: 4yl8 A:199-296 [271139] Other proteins in same PDB: d4yl8a1, d4yl8a2 automated match to d2zpya2 complexed with gol, iod |
PDB Entry: 4yl8 (more details), 1.5 Å
SCOPe Domain Sequences for d4yl8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yl8a3 b.55.1.5 (A:199-296) Moesin {Mouse (Mus musculus) [TaxId: 10090]} emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrk
Timeline for d4yl8a3: