SCOPe 2.07: Domain d4yl8a3: 4yl8 A:199-296

Lineage for d4yl8a3 (4yl8 A:199-296)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Moesin [50777] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [311105] (1 PDB entry)

8. Domain d4yl8a3: 4yl8 A:199-296 [271139]
   Other proteins in same PDB: d4yl8a1, d4yl8a2
   automated match to d2zpya2
   complexed with gol, iod

Details for d4yl8a3

PDB Entry: 4yl8, 1.5 Å

PDB Description: crystal structure of the crumbs/moesin complex

PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d4yl8a3:

Sequence; same for both SEQRES and ATOM records:

>d4yl8a3 b.55.1.5 (A:199-296) Moesin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrk

Timeline for d4yl8a3:

• d4yl8a3 first appeared in SCOPe 2.05
  
• d4yl8a3 appears in SCOPe 2.06
  
• d4yl8a3 appears in the current release, SCOPe 2.08