Lineage for d4yl8a3 (4yl8 A:199-296)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071416Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2071438Protein Moesin [50777] (2 species)
  7. 2071444Species Mouse (Mus musculus) [TaxId:10090] [311105] (1 PDB entry)
  8. 2071445Domain d4yl8a3: 4yl8 A:199-296 [271139]
    Other proteins in same PDB: d4yl8a1, d4yl8a2
    automated match to d2zpya2
    complexed with gol, iod

Details for d4yl8a3

PDB Entry: 4yl8 (more details), 1.5 Å

PDB Description: crystal structure of the crumbs/moesin complex
PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d4yl8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yl8a3 b.55.1.5 (A:199-296) Moesin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrk

SCOPe Domain Coordinates for d4yl8a3:

Click to download the PDB-style file with coordinates for d4yl8a3.
(The format of our PDB-style files is described here.)

Timeline for d4yl8a3: