Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [238064] (3 PDB entries) |
Domain d4yrub_: 4yru B: [271134] automated match to d1ikua_ complexed with ca |
PDB Entry: 4yru (more details), 2.8 Å
SCOPe Domain Sequences for d4yrub_:
Sequence, based on SEQRES records: (download)
>d4yrub_ a.39.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} lkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatf vfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivda iyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegska
>d4yrub_ a.39.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} lkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatf vfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivda iyqmvgntventpekrvdrifammdknadgkltlqefqegska
Timeline for d4yrub_: