Lineage for d4yeeb_ (4yee B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771012Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 1771017Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species)
  7. 1771020Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (4 PDB entries)
  8. 1771024Domain d4yeeb_: 4yee B: [271115]
    automated match to d2f15a1
    complexed with 4cq, gol

Details for d4yeeb_

PDB Entry: 4yee (more details), 2 Å

PDB Description: beta2 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclodextrin
PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d4yeeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yeeb_ b.1.18.21 (B:) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqw
vhdpsepvvtsqlgtinnlihvk

SCOPe Domain Coordinates for d4yeeb_:

Click to download the PDB-style file with coordinates for d4yeeb_.
(The format of our PDB-style files is described here.)

Timeline for d4yeeb_: