SCOPe 2.08: Domain d4y34a1: 4y34 A:1-462

Lineage for d4y34a1 (4y34 A:1-462)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein automated matches [190260] (25 species)
   not a true protein

7. Species Coxsackievirus b3 [TaxId:12072] [271111] (10 PDB entries)

8. Domain d4y34a1: 4y34 A:1-462 [271113]
   Other proteins in same PDB: d4y34a2
   automated match to d4wfza_
   complexed with 45z, gol, so4

Details for d4y34a1

PDB Entry: 4y34, 2.7 Å

PDB Description: crystal structure of coxsackievirus b3 3d polymerase in complex with gpc-n143

PDB Compounds: (A:) 3D polymerase

SCOPe Domain Sequences for d4y34a1:

Sequence; same for both SEQRES and ATOM records:

>d4y34a1 e.8.1.4 (A:1-462) automated matches {Coxsackievirus b3 [TaxId: 12072]}
geiefiesskdagfpvintpsktklepsvfhqvfegnkepavlrsgdprlkanfeeaifs
kyignvnthvdeymleavdhyagqlatldistepmkledavygteglealdlttsagypy
valgikkrdilskktkdltklkecmdkyglnlpmvtyvkdelrsiekvakgksrlieass
lndsvamrqtfgnlyktfhlnpgvvtgsavgcdpdlfwskipvmldghliafdysgydas
lspvwfaclkmileklgythketnyidylcnshhlyrdkhyfvrggmpsgcsgtsifnsm
inniiirtlmlkvykgidldqfrmiaygddviasypwpidasllaeagkgyglimtpadk
gecfnevtwtnvtflkryfradeqypflvhpvmpmkdihesirwtkdpkntqdhvrslcl
lawhngeheyeefirkirsvpvgrcltlpafstlrrkwldsf

Timeline for d4y34a1:

• d4y34a1 first appeared in SCOPe 2.05, called d4y34a_
  
• d4y34a1 appears in SCOPe 2.07