Lineage for d4xeyb2 (4xey B:251-523)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1931656Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)
  8. 1932423Domain d4xeyb2: 4xey B:251-523 [271087]
    Other proteins in same PDB: d4xeyb1
    automated match to d1opka3
    complexed with 1n1

Details for d4xeyb2

PDB Entry: 4xey (more details), 2.89 Å

PDB Description: crystal structure of an sh2-kinase domain construct of c-abl tyrosine kinase
PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d4xeyb2:

Sequence, based on SEQRES records: (download)

>d4xeyb2 d.144.1.7 (B:251-523) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqessisd

Sequence, based on observed residues (ATOM records): (download)

>d4xeyb2 d.144.1.7 (B:251-523) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydkwemertditmkhklevyegvwkkysltvavktltmeveeflkeaavmkeikhpnlvq
llgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfi
hrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiks
dvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnp
sdrpsfaeihqafetmfqessisd

SCOPe Domain Coordinates for d4xeyb2:

Click to download the PDB-style file with coordinates for d4xeyb2.
(The format of our PDB-style files is described here.)

Timeline for d4xeyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xeyb1
View in 3D
Domains from other chains:
(mouse over for more information)
d4xeya_