SCOPe 2.05: Domain d4xeyb1: 4xey B:141-238

Lineage for d4xeyb1 (4xey B:141-238)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (41 PDB entries)

8. Domain d4xeyb1: 4xey B:141-238 [271086]
   Other proteins in same PDB: d4xeya_, d4xeyb2
   automated match to d1opla2
   complexed with 1n1

Details for d4xeyb1

PDB Entry: 4xey, 2.89 Å

PDB Description: crystal structure of an sh2-kinase domain construct of c-abl tyrosine kinase

PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d4xeyb1:

Sequence, based on SEQRES records:

>d4xeyb1 d.93.1.0 (B:141-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasd
gklyvssesrfntlaelvhhhstvadglittlhypapk

Sequence, based on observed residues (ATOM records):

>d4xeyb1 d.93.1.0 (B:141-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasd
gklyvsrfntlaelvhhhstvadglittlhypapk

Timeline for d4xeyb1:

• d4xeyb1 is new in SCOPe 2.05-stable
  
• d4xeyb1 appears in SCOPe 2.06
  
• d4xeyb1 appears in the current release, SCOPe 2.08