SCOPe 2.08: Domain d4xkdb_: 4xkd B:

Lineage for d4xkdb_ (4xkd B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)

8. Domain d4xkdb_: 4xkd B: [271074]
   Other proteins in same PDB: d4xkda_, d4xkdc_, d4xkde_
   automated match to d4h32b_
   complexed with nag

Details for d4xkdb_

PDB Entry: 4xkd, 2.48 Å

PDB Description: crystal structure of hemagglutinin from taiwan (2013) h6n1 influenza virus

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xkdb_:

Sequence; same for both SEQRES and ATOM records:

>d4xkdb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg

Timeline for d4xkdb_:

• d4xkdb_ first appeared in SCOPe 2.05
  
• d4xkdb_ appears in SCOPe 2.07