Lineage for d4twmb_ (4twm B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2812758Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2812759Protein automated matches [191011] (16 species)
    not a true protein
  7. 2812763Species Dioscorea japonica [TaxId:4673] [271037] (2 PDB entries)
  8. 2812767Domain d4twmb_: 4twm B: [271041]
    automated match to d3rg4a_
    complexed with so4

Details for d4twmb_

PDB Entry: 4twm (more details), 2.11 Å

PDB Description: crystal structure of dioscorin from dioscorea japonica
PDB Compounds: (B:) Dioscorin 5

SCOPe Domain Sequences for d4twmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4twmb_ b.74.1.0 (B:) automated matches {Dioscorea japonica [TaxId: 4673]}
efsyidgnpngpenwgnlkpewetcgkgmeqspiqlrdnrvifdqtlgklrrnyravdar
lrnsghdvlvdfkgnagslsinrveyqlkrihfhspsehemngerfdleaqlvhesqdqk
ravvsilfrfgradpflsdledfikqfsnsqkneinagvvdpnqlqiddsayyrymgsft
appctegiswtvmrkvatvsprqvlllkqavnenainnarplqptnfrsvfyfeql

SCOPe Domain Coordinates for d4twmb_:

Click to download the PDB-style file with coordinates for d4twmb_.
(The format of our PDB-style files is described here.)

Timeline for d4twmb_: